Recombinant Mouse Vascular endothelial growth factor C (Vegfc), Unconjugated, Yeast

Produktübersicht

• Artikelname: Recombinant Mouse Vascular endothelial growth factor C (Vegfc), Unconjugated, Yeast
• Artikelnummer: BIM-RPC30573
• Hersteller Artikelnummer: RPC30573
• Alternativnummer: BIM-RPC30573-20UG,BIM-RPC30573-100UG,BIM-RPC30573-1MG
• Hersteller: Biomatik Corporation
• Wirt: Yeast
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Konjugation: Unconjugated
• Alternative Synonym: Flt4 ligand, Flt4-LVascular endothelial growth factor-related protein, VRP

Produktbeschreibung

Accession Number: P97953; Vegfc. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 108-223aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 15kDa
• Tag: N-Terminal 6xHis-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
• Target-Kategorie: Vascular endothelial growth factor C (Vegfc)