Recombinant Toxoplasma gondii Profilin (PRF), Unconjugated, Yeast

Artikelnummer: BIM-RPC30574
Artikelname: Recombinant Toxoplasma gondii Profilin (PRF), Unconjugated, Yeast
Artikelnummer: BIM-RPC30574
Hersteller Artikelnummer: RPC30574
Alternativnummer: BIM-RPC30574-20UG,BIM-RPC30574-100UG,BIM-RPC30574-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Parasite
Konjugation: Unconjugated
Accession Number: Q58NA1; PRF. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-163aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Toxoplasma gondii Profilin (PRF) is a purified Recombinant Protein
Molekulargewicht: 19.4kDa
Tag: N-Terminal 6xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY
Target-Kategorie: Profilin (PRF)