Anti-SARS-CoV-2 NSP9 Antibody Fluoro488 Conjugated, Rabbit, Polyclonal
Artikelnummer:
BOB-A30395-FLUORO488
| Artikelname: |
Anti-SARS-CoV-2 NSP9 Antibody Fluoro488 Conjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BOB-A30395-FLUORO488 |
| Hersteller Artikelnummer: |
A30395-Fluoro488 |
| Alternativnummer: |
BOB-A30395-FLUORO488-100UG/VIAL |
| Hersteller: |
Boster Bio |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
FC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Alternative Synonym: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9 |
| Klonalität: |
Polyclonal |
| Konzentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Molekulargewicht: |
Calculated Molecular Weight: 16693 MW |
| NCBI: |
43740578 |
| UniProt: |
P0DTC1 |
| Puffer: |
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. |
| Reinheit: |
Immunogen affinity purified. |
| Formulierung: |
Liquid |
| Target-Kategorie: |
Synapsin-1 |
| Application Verdünnung: |
Flow Cytometry, 1-3µg/1x106 cells |