Anti-SARS-CoV-2 NSP9 Antibody Fluoro550 Conjugated, Rabbit, Polyclonal

Artikelnummer: BOB-A30395-FLUORO550
Artikelname: Anti-SARS-CoV-2 NSP9 Antibody Fluoro550 Conjugated, Rabbit, Polyclonal
Artikelnummer: BOB-A30395-FLUORO550
Hersteller Artikelnummer: A30395-Fluoro550
Alternativnummer: BOB-A30395-FLUORO550-100UG/VIAL
Hersteller: Boster Bio
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Human
Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Alternative Synonym: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9
Klonalität: Polyclonal
Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molekulargewicht: Calculated Molecular Weight: 16693 MW
NCBI: 43740578
UniProt: P0DTC1
Puffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Reinheit: Immunogen affinity purified.
Formulierung: Liquid
Target-Kategorie: Synapsin-1
Application Verdünnung: Flow Cytometry, 1-3µg/1x106 cells