Anti-SARS-CoV-2 NSP9 Antibody, iFluor647, Rabbit, Polyclonal

Artikelnummer: BOB-A30395-IFLUOR647
Artikelname: Anti-SARS-CoV-2 NSP9 Antibody, iFluor647, Rabbit, Polyclonal
Artikelnummer: BOB-A30395-IFLUOR647
Hersteller Artikelnummer: A30395-iFluor647
Alternativnummer: BOB-A30395-IFLUOR647-100UG
Hersteller: Boster Bio
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Konjugation: iFluor647
Alternative Synonym: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9
Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog A30395. Tested in ELISA applications. This antibody reacts with Human.
Klonalität: Polyclonal
Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molekulargewicht: 140 kDa, 130 kDa, 110 kDa
UniProt: P0DTC1
Puffer: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Reinheit: Immunogen affinity purified.
Formulierung: Lyophilized
Application Verdünnung: ELISA, 0.001-0.1µg/ml, Human