Anti-SARS-CoV-2 NSP3 Antibody Cy3 Conjugated, Rabbit, Polyclonal

Artikelnummer: BOB-A33999-CY3
Artikelname: Anti-SARS-CoV-2 NSP3 Antibody Cy3 Conjugated, Rabbit, Polyclonal
Artikelnummer: BOB-A33999-CY3
Hersteller Artikelnummer: A33999-Cy3
Alternativnummer: BOB-A33999-CY3-100UG,BOB-A33999-CY3-100UG/VIAL
Hersteller: Boster Bio
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Human
Immunogen: HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK
Konjugation: Cy3
Alternative Synonym: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp3, Non-structural protein 3, PL2-PRO, Papain-like proteinase, PL-PRO
Boster Bio Anti-SARS-CoV-2 NSP3 Antibody catalog A33999. Tested in ELISA applications. This antibody reacts with Human.
Klonalität: Polyclonal
Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molekulargewicht: Calculated Molecular Weight: 16693 MW
NCBI: 43740578
UniProt: P0DTC1
Puffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Reinheit: Immunogen affinity purified.
Formulierung: Liquid
Application Verdünnung: Flow Cytometry, 1-3µg/1x106 cells