Anti-SARS-CoV-2 NSP3 Antibody Cy3 Conjugated, Rabbit, Polyclonal
Artikelnummer:
BOB-A33999-CY3
| Artikelname: |
Anti-SARS-CoV-2 NSP3 Antibody Cy3 Conjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BOB-A33999-CY3 |
| Hersteller Artikelnummer: |
A33999-Cy3 |
| Alternativnummer: |
BOB-A33999-CY3-100UG,BOB-A33999-CY3-100UG/VIAL |
| Hersteller: |
Boster Bio |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
FC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK |
| Konjugation: |
Cy3 |
| Alternative Synonym: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp3, Non-structural protein 3, PL2-PRO, Papain-like proteinase, PL-PRO |
| Boster Bio Anti-SARS-CoV-2 NSP3 Antibody catalog A33999. Tested in ELISA applications. This antibody reacts with Human. |
| Klonalität: |
Polyclonal |
| Konzentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Molekulargewicht: |
Calculated Molecular Weight: 16693 MW |
| NCBI: |
43740578 |
| UniProt: |
P0DTC1 |
| Puffer: |
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. |
| Reinheit: |
Immunogen affinity purified. |
| Formulierung: |
Liquid |
| Application Verdünnung: |
Flow Cytometry, 1-3µg/1x106 cells |