Human recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF

Artikelnummer: BOB-PROTO43508-2-5UG
Artikelname: Human recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF
Artikelnummer: BOB-PROTO43508-2-5UG
Hersteller Artikelnummer: PROTO43508-2-5ug
Alternativnummer: BOB-PROTO43508-2-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: TNFSF12, DR3LG, Apo3 Ligand
TNF-related weak inducer of apoptosis (TWEAK) is a type II membrane protein of the tumor necrosis factor (TNF) family members, high levels expression in human brain, muscle, heart, spleen, and thymus. TWEAK is a 17.3 kDa protein containing 129 residues. TWEAK induce apoptosis through cognate receptor Fn14 activate caspase-8 and caspase-3, in HSC3 cells KATO-III gastric adenocarcinoma cells and IFN-gamma-treated HT-29. TWEAK stimulate inflammatory cytokines in HT-29, A375 cells, WI-38 fibroblast sand astrocytes.
Molekulargewicht: The protein has a calculated MW of 17.88 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: O43508
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus.