Human recombinant LIGHT protein, AF

Artikelnummer: BOB-PROTO43557-3-20UG
Artikelname: Human recombinant LIGHT protein, AF
Artikelnummer: BOB-PROTO43557-3-20UG
Hersteller Artikelnummer: PROTO43557-3-20ug
Alternativnummer: BOB-PROTO43557-3-20UG-20UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: TNFSF14, HVEM-L, CD258, LTg
LIGHT, also known as TNFSF14 is a member of the TNF superfamily that produced by multiple immune cells such as activated T cells and immature dendritic cells (DCs). LIGHT is a 29 kDa type II transmembrane protein, which serves as a ligand for both lymphotoxin beta receptor (LTbetaR) and TNFSF signaling receptors (TNFRSF14/HVEM). Besides, LIGHT can amplify NF-kB signaling pathway in T cells when presenting anti-CD3 antibody treatment. Additionally, LIGHT can stimulate T cell proliferation and IFN-expression via interacting with TNFRS13 /HVEM.
Molekulargewicht: The protein has a calculated MW of 20.30 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: O43557
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 0.1% sarkosyl in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV with polyhistidine tag at the C-terminus.