Human recombinant FGF-1 (Fibroblast growth factor-acidic) protein, AF

Artikelnummer: BOB-PROTP05230-4-20UG
Artikelname: Human recombinant FGF-1 (Fibroblast growth factor-acidic) protein, AF
Artikelnummer: BOB-PROTP05230-4-20UG
Hersteller Artikelnummer: PROTP05230-4-20ug
Alternativnummer: BOB-PROTP05230-4-20UG-20UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: HBGF-1, ECGF-beta
Fibroblast Growth Factors-1 (FGF-1) is a Growth Factors of mitogenic peptides which is a 15 kDa protein containing 139 amino acid residues. Fibroblast Growth Factors-1 is secreted by the macrophage which induce endothelial cell proliferation and angiogenesis. During wound injury, fibroblast Growth Factors-1 helps the tissue remodeling. When the fibroblast Growth Factors-1 binds with the FGFR on the cell membrane which is endocytosed by FGFR and induces the cell cycle.
Molekulargewicht: The protein has a calculated MW of 16.77 kDa. The protein migrates as 18kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P05230
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD with polyhistidine tag at the C-terminus.