Mouse recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF

Artikelnummer: BOB-PROTP06804-6-5UG
Artikelname: Mouse recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF
Artikelnummer: BOB-PROTP06804-6-5UG
Hersteller Artikelnummer: PROTP06804-6-5ug
Alternativnummer: BOB-PROTP06804-6-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: TNFSF2, Cachectin, Differentiation-inducing factor (DIF), Necrosin, Cytotoxin, TNSF1A, TNF-a
Tumor necrosis factor alpha (TNF alpha) stimulates the acute phase of the immune response. In response to a pathogen, TNF alpha is one of the first to be released and can apply its effects in many organs. TNF alpha stimulates the release of corticotropic releasing hormone, suppresses appetite, and induces fever, in the hypothalamus. TNF increase vasodilation and loss of vascular permeability, it helps recruit lymphocyte, neutrophil, and monocyte to the inflammation site by regulating chemokine release.
Molekulargewicht: The protein has a calculated MW of 18.2 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P06804
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYL DFAESGQVYFGVIAL with polyhistidine tag at the C-terminus.