Mouse recombinant IL-4 (Interleukin-4) protein, AF

Artikelnummer: BOB-PROTP07750-2-20UG
Artikelname: Mouse recombinant IL-4 (Interleukin-4) protein, AF
Artikelnummer: BOB-PROTP07750-2-20UG
Hersteller Artikelnummer: PROTP07750-2-20ug
Alternativnummer: BOB-PROTP07750-2-20UG-20UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: BCGF, BCDF, B-cell Stimulating Factor (BSF-1)
Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch.
Molekulargewicht: The protein has a calculated MW of 14.5 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P07750
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS with polyhistidine tag at the C-terminus.