Mouse recombinant IL-1 beta (Interleukin-1 beta) protein, AF

Artikelnummer: BOB-PROTP10749-5-5UG
Artikelname: Mouse recombinant IL-1 beta (Interleukin-1 beta) protein, AF
Artikelnummer: BOB-PROTP10749-5-5UG
Hersteller Artikelnummer: PROTP10749-5-5ug
Alternativnummer: BOB-PROTP10749-5-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF)
Interleukin-1 beta (IL-1beta) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1beta is cleaved by cytosolic caspase 1 to form mature IL-1beta.
Molekulargewicht: The protein has a calculated MW of 18.3 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P10749
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS with polyhistidine tag at the C-terminus.