Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF

Artikelnummer: BOB-PROTP10855-4-100UG
Artikelname: Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF
Artikelnummer: BOB-PROTP10855-4-100UG
Hersteller Artikelnummer: PROTP10855-4-100ug
Alternativnummer: BOB-PROTP10855-4-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: MIP-1a: Macrophage Inflammatory Protein-1alpha, LD78alpha
C-C Motif Chemokine Ligand 3 (CCL3) is a 7.66 kDa cytokine with 69 amino acid residues. CCL3, also known as macrophage inflammatory protein 1-alpha (MIP-1-alpha), is expressed in the spleen, lung, and articular cartilage. Upon binding to the receptor, CCR1, CCR4, or CCR5, CCL3 plays a vital role in immune response, such as inflammation, recruitment of immune cells, and production of IL-1beta and TNF. In addition, CCL3 also participates in resistance to type 1 virus infection, astrocyte cell migration, regulation of macromolecule metabolic process, and regulation of ERK1 and ERK2 cascade.
Molekulargewicht: The protein has a calculated MW of 8.69 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P10855
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus.