Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF

Artikelnummer: BOB-PROTP14097-2-5UG
Artikelname: Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF
Artikelnummer: BOB-PROTP14097-2-5UG
Hersteller Artikelnummer: PROTP14097-2-5ug
Alternativnummer: BOB-PROTP14097-2-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: MIP-1b: Macrophage Inflammatory Protein-1beta, ACT-2
C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1beta (MIP-1beta), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells, and epithelial cells. In addition, CCL4 participates in immune responses, including recruitment of immune cells like lymphocytes, monocytes, and leukocytes, response to IL-1 and IFNgamma, and production of TNF when CCL4 binds to CCR5.
Molekulargewicht: The protein has a calculated MW of 8.64 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P14097
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN with polyhistidine tag at the N-terminus.