Human recombinant LIF protein, AF

Artikelnummer: BOB-PROTP15018-8-100UG
Artikelname: Human recombinant LIF protein, AF
Artikelnummer: BOB-PROTP15018-8-100UG
Hersteller Artikelnummer: PROTP15018-8-100ug
Alternativnummer: BOB-PROTP15018-8-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor (MLPLI), Interleukin 6 family cytokine
Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein, belonging to the IL-6 receptor family. LIF is a 19.7 kDa protein containing 202 amino acid which high expression in human liver, bone, uterus, kidney and the central nervous system. LIF is an inducer of differentiation in M1 leukemia cells, osteoblasts and glia. Not only stimulates proliferation of DA1 cells inhibits proliferation of corticotrophs and promote cell survival in some cell types but also induce apoptosis in others.
Molekulargewicht: The protein has a calculated MW of 20.52 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P15018
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF with polyhistidine tag at the N-terminus.