Human recombinant CD326 protein, AF

Artikelnummer: BOB-PROTP16422-4-100UG
Artikelname: Human recombinant CD326 protein, AF
Artikelnummer: BOB-PROTP16422-4-100UG
Hersteller Artikelnummer: PROTP16422-4-100ug
Alternativnummer: BOB-PROTP16422-4-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: EPCAM, DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1
Human CD326 also called epithelial cellular adhesion molecule (EpCAM), which is a 28 kDa protein containing 242 amino acid residues. Human CD326 is a transmembrane glycoprotein, which is a marker of cancer. CD326 induces the expression of c-myc, cyclins A & E and e-fabp which is involved the cancer cell proliferation and migration.
Molekulargewicht: The protein has a calculated MW of 28.36 kDa. The protein migrates as 30 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P16422
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK with polyhi