Human CD326 also called epithelial cellular adhesion molecule (EpCAM), which is a 28 kDa protein containing 242 amino acid residues. Human CD326 is a transmembrane glycoprotein, which is a marker of cancer. CD326 induces the expression of c-myc, cyclins A & E and e-fabp which is involved the cancer cell proliferation and migration.
Molekulargewicht:
The protein has a calculated MW of 28.36 kDa. The protein migrates as 30 kDa under reducing condition (SDS-PAGE analysis).
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz:
MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK with polyhi
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten