Mouse recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

Artikelnummer: BOB-PROTP17515-2-20UG
Artikelname: Mouse recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF
Artikelnummer: BOB-PROTP17515-2-20UG
Hersteller Artikelnummer: PROTP17515-2-20ug
Alternativnummer: BOB-PROTP17515-2-20UG-20UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: IP-10, Gamma-Interferon Inducible Protein 10, Crg-2
C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 8.55 kDa protein containing 77 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responsed for IFNgamma. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induces the cell migration and activation like T cells and dendritic cells.
Molekulargewicht: The protein has a calculated MW of 9.47 kDa. The protein migrates as 7-11 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P17515
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP with polyhistidine tag at the N-terminus.