Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF

Artikelnummer: BOB-PROTP18340-1-100UG
Artikelname: Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF
Artikelnummer: BOB-PROTP18340-1-100UG
Hersteller Artikelnummer: PROTP18340-1-100ug
Alternativnummer: BOB-PROTP18340-1-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: Monokine Induced by Interferon-gamma, MIG
C-X-C motif chemokine 9 (CXCL9) also named monokine induced by gamma interferon (MIG), which is a chemokine of the intercrine alpha family. CXCL9 is a 11.7 kDa protein containing 10? amino acid residues. CXCL9 controls the immune cells by binding the CXCR3 which is including the cell migration and activation. During inflammation, CXCL9 is a chemotaxis for lymphocyte and macrophages. CXCL9 is participated in the process of tumor proliferation and metastasis.
Molekulargewicht: The protein has a calculated MW of 13.00 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P18340
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT with polyhistidine tag at the N-terminus.