Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF

Artikelnummer: BOB-PROTP18510-5-500UG
Artikelname: Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF
Artikelnummer: BOB-PROTP18510-5-500UG
Hersteller Artikelnummer: PROTP18510-5-500ug
Alternativnummer: BOB-PROTP18510-5-500UG-500UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: ICIL-1RA, IRAP, IL-1RN
Interleukin 1 receptor antagonist (IL-1RA) is a 17.26 kDa member of IL-1 family with 153 amino acid residues. IL-1RA is expressed by peripheral blood cells, lungs, spleen, liver and is secreted from monocytes, macrophages, neutrophils, and other cells. Inhibits the activity of interleukin-1 by binding to receptor IL1R1. IL-1RA can modulate a variety of interleukin-1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation.
Molekulargewicht: The protein has a calculated MW of 18.07 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P18510
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE with polyhistidine tag at the C-terminus.