Mouse recombinant IL-10 (Interleukin-10) protein, AF

Artikelnummer: BOB-PROTP18893-2-100UG
Artikelname: Mouse recombinant IL-10 (Interleukin-10) protein, AF
Artikelnummer: BOB-PROTP18893-2-100UG
Hersteller Artikelnummer: PROTP18893-2-100ug
Alternativnummer: BOB-PROTP18893-2-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: B-TCGF, CSIF, TGIF
Interleukin-10 (IL-10), also known as cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine. Many different types of cells can produce IL-10, including immune cells and non-immune cells. IL-10 exerts inhibitory functions on DCs and macrophages, which is a potent inhibitor of antigen presentation and limit the production of the Th1-associated cytokines IL-2 and interferon-gamma (IFN-gamma). IL-10 is also a key immunoregulator during infection due to its inhibitory effect on inflammatory cytokine production. Consequently, the excessive Th1 and CD8+ T cell responses could be suppressed during infection.
Molekulargewicht: The protein has a calculated MW of 19.7 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P18893
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS with polyhistidine tag at the C-terminus.