Human recombinant Midkine protein, AF

Artikelnummer: BOB-PROTP21741-3-5UG
Artikelname: Human recombinant Midkine protein, AF
Artikelnummer: BOB-PROTP21741-3-5UG
Hersteller Artikelnummer: PROTP21741-3-5ug
Alternativnummer: BOB-PROTP21741-3-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: MK, NEGF-2, ARAP
Midkine, also known as neurite growth-promoting factor 2 (NEGF2) is a member of a small family of secreted Growth Factorss, furthermore high expression in lymph node, endometrium, spleen, and colon. Midkine is a 13.5 kDa protein containing 143 amino acids, which promotes angiogenesis, cell growth, migration, and gene expression of different cell types probably via a multiprotein receptor complex consisting of several molecules.
Molekulargewicht: The protein has a calculated MW of 14.36 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P21741
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequenz: MVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD with polyhistidine tag at the C-terminus.