Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF

Artikelnummer: BOB-PROTP23560-5-5UG
Artikelname: Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF
Artikelnummer: BOB-PROTP23560-5-5UG
Hersteller Artikelnummer: PROTP23560-5-5ug
Alternativnummer: BOB-PROTP23560-5-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human, Mouse, Rat
Alternative Synonym: ANON2, BULN2
Brain-derived neurotrophic factor (BDNF) is a member of neurotrophin family that not only primarily expressed in hippocampus, amygdala, cerebral cortex, hypothalamus and cerebellum but also has been detected in blood platelets and in circulating plasma. BDNF is a 27.8 kDa protein containing 247 residues, which plays a critical role in regulating synaptic transmission and plasticity in various region of the CNS. Additionally, BNDF can acts as a modulator in the long-term potentiation of memory-related modifications in hippocampal synaptic transmission.
Molekulargewicht: The protein has a calculated MW of 14.45 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P23560
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequenz: MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR with polyhistidine tag at the C-terminus.