Human recombinant IL-32 alpha (Interleukin-32 alpha) protein, AF

Artikelnummer: BOB-PROTP24001-3-100UG
Artikelname: Human recombinant IL-32 alpha (Interleukin-32 alpha) protein, AF
Artikelnummer: BOB-PROTP24001-3-100UG
Hersteller Artikelnummer: PROTP24001-3-100ug
Alternativnummer: BOB-PROTP24001-3-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd
Interleukin 32 alpha (IL-32alpha) is an 18 kDa cytokine with 131 amino acid residues and one of the IL-2 splice variants. IL-32alpha is primarily secreted from inflammatory cells, such as NK cells, T-cells, peripheral blood mononuclear cells (PBMCs), and monocytes. IL-32 alpha is a proinflammatory cytokine regulating IL-6 by interaction with protein kinase C(PKC). It also interacts with paxillin, integrin, and focal adhesion kinase 1 (FAK 1).
Molekulargewicht: The protein has a calculated MW of 15.72 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P24001
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK with polyhistidine tag at the C-terminus .