Mouse recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF

Artikelnummer: BOB-PROTP25085-3-5UG
Artikelname: Mouse recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF
Artikelnummer: BOB-PROTP25085-3-5UG
Hersteller Artikelnummer: PROTP25085-3-5ug
Alternativnummer: BOB-PROTP25085-3-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: ICIL-1RA, IRAP, IL-1RN, F630041P17Rik
Interleukin 1 receptor antagonist (IL-1RA) predicts a molecular mass of 19.8 kDa, is a member of the IL-1 family that binds to IL-1 receptors but does not induce any intracellular response. Two structural variants of IL-1RA have previously been described: a 17 kDa form that is secreted from monocytes, macrophages, neutrophils, and other cells (sIL-1RA) and an 18 kDa form that remains in the cytoplasm of keratinocytes and other epithelial cells, monocytes, and fibroblasts (icIL-1RA).
Molekulargewicht: The protein has a calculated MW of 18.27 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P25085
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ with polyhistidine tag at the C-terminus.