Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF

Artikelnummer: BOB-PROTP50592-2-100UG
Artikelname: Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF
Artikelnummer: BOB-PROTP50592-2-100UG
Hersteller Artikelnummer: PROTP50592-2-100ug
Alternativnummer: BOB-PROTP50592-2-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: TNFSF10, Apo2 Ligand, TL2, Apo2L, CD253
Tumor Necrosis Factor associated Apoptosis Inducing Ligand (TRAIL) is a type II membrane protein of the tumor necrosis factor (TNF) family members, moreover expressed in many adult tissues including the thymus, prostate, colon, ovary and lung. TRAIL is a 19 kDa protein containing 281 residues. Mouse TRAIL shares 70% amino acids sequence identity with human, bovine, and porcine. TRAIL to induce apoptosis in human breast carcinoma cells (MCF7) and human epithelioid carcinoma (HeLa) cell lines, by activate two death receptors of DR4 and DR5 or two decoy receptors DcR1 and DcR2.
Molekulargewicht: The protein has a calculated MW of 21.00 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P50592
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN with polyhistidine tag at the C-terminus.