Human recombinant CXCL6 (C-X-C motif chemokine 6) protein, AF

Artikelnummer: BOB-PROTP80162-2-100UG
Artikelname: Human recombinant CXCL6 (C-X-C motif chemokine 6) protein, AF
Artikelnummer: BOB-PROTP80162-2-100UG
Hersteller Artikelnummer: PROTP80162-2-100ug
Alternativnummer: BOB-PROTP80162-2-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: Granulocyte Chemotactic Protein-2,GCP-2
C-X-C motif chemokine 6 (CXCL6) also named granulocyte chemotactic protein 2 (GCP-2), which is a chemokine of the intercrine alpha family. CXCL6 is a 8.3kDa protein containing 75 amino acid residues. CXCL6 has a significant role in resistance of gram-positive and gram-negative bacteria which is a chemotaxis for neutrophil granulocytes. CXCL6 has a role in in the process of carcinogenesis which affects proliferation and metastasis of OS cells by the interaction with CXCR1 /CXCR2.
Molekulargewicht: The protein has a calculated MW of 8.97 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: P80162
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: VSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN with polyhistidine tag at the N-terminus.