Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF

Artikelnummer: BOB-PROTQ00731-6-100UG
Artikelname: Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF
Artikelnummer: BOB-PROTQ00731-6-100UG
Hersteller Artikelnummer: PROTQ00731-6-100ug
Alternativnummer: BOB-PROTQ00731-6-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: VPF
Vascular Endothelial Growth Factors 121 (VEGF121) is a truncated version of VEGF165, which produced in E. coli is a homodimer, non-glycosylated, polypeptide chain and having a molecular mass of 28.4 kDa. There is three different isoforms (120, 164 and 188 a.a.) found in mouse. VEGF 121 shows that lack basic heparin-binding regions and are freely diffusible. Mouse VEGF121 shares 98% identity with corresponding regions of rat, 89% with canine, feline, equine and porcine, and 87% with human, ovine and bovine VEGF, respectively.
Molekulargewicht: The protein has a calculated MW of 15.01 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q00731
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR with polyhistidine tag at the C-terminus.