Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

Artikelnummer: BOB-PROTQ00731-7-20UG
Artikelname: Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF
Artikelnummer: BOB-PROTQ00731-7-20UG
Hersteller Artikelnummer: PROTQ00731-7-20ug
Alternativnummer: BOB-PROTQ00731-7-20UG-20UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen
Vascular Endothelial Growth Factors 165 (VEGF165) is a potent growth and angiogenic cytokine which belongs to the VEGF family, includes VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. VEGF165 is an abundant glycosylated cytokine composed of two identical 165 amino acid chains. VEGF165 plays an important role in embryonic vasculogenesis, angiogenesis and neurogenesis.
Molekulargewicht: The protein has a calculated MW of 20.22 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q00731
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.