Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF

Artikelnummer: BOB-PROTQ9GZV9-5-100UG
Artikelname: Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF
Artikelnummer: BOB-PROTQ9GZV9-5-100UG
Hersteller Artikelnummer: PROTQ9GZV9-5-100ug
Alternativnummer: BOB-PROTQ9GZV9-5-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: FGFN
Fibroblast Growth Factors-23 (FGF-23) is a 28 kDa member of the fibroblast Growth Factors with 251 amino acid residues. FGF-23 is expressed from brain, hepatic stellate cells, cone photoreceptor cells, early spermatids. FGF-23 involved phosphate metabolism and vitamin D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.
Molekulargewicht: The protein has a calculated MW of 26.27 kDa. The protein migrates as 26 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q9GZV9
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI with polyhistidine tag at