Human recombinant FGF-21 (Fibroblast growth factor-21) protein, AF

Artikelnummer: BOB-PROTQ9NSA1-4-100UG
Artikelname: Human recombinant FGF-21 (Fibroblast growth factor-21) protein, AF
Artikelnummer: BOB-PROTQ9NSA1-4-100UG
Hersteller Artikelnummer: PROTQ9NSA1-4-100ug
Alternativnummer: BOB-PROTQ9NSA1-4-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: FGFL
Fibroblast Growth Factors-21 (FGF-21) is a 22.3 kDa member of the fibroblast Growth Factors with 209 amino acid residues. FGF-21 is expressed from liver and cardiomyocytes. FGF-21 is a key protein that regulates important metabolic pathways, and modulates cellular function, metabolism, and senescence. It can stimulate glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1 /GLUT1 expression.
Molekulargewicht: The protein has a calculated MW of 20.35 kDa. The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q9NSA1
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS with polyhistidine tag at the C-terminus.