Human recombinant IL-36 alpha (Interleukin-36 alpha) protein, AF

Artikelnummer: BOB-PROTQ9UHA7-2-20UG
Artikelname: Human recombinant IL-36 alpha (Interleukin-36 alpha) protein, AF
Artikelnummer: BOB-PROTQ9UHA7-2-20UG
Hersteller Artikelnummer: PROTQ9UHA7-2-20ug
Alternativnummer: BOB-PROTQ9UHA7-2-20UG-20UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: IL36A, Interleukin-1 family member 6 (IL-1F6), FIL1epsilon (FIL1E), Interleukin-1epsilon (IL1E)
Interleukin-36 alpha (IL-36alpha) is an 18 kDa cytokine with 154 amino acid residues. IL-36alpha is one of the IL-36 agonists secreted from keratinocytes. When IL-36alpha binds to the IL-36 receptor, it activates NF-kappaB and MAPK signaling pathways that induce inflammatory responses. In addition, it also stimulates the production of inflammatory cytokines, such as IFN-gamma, TNF-alpha, and IL-6.
Molekulargewicht: The protein has a calculated MW of 18.05 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q9UHA7
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF with polyhistidine tag at the C-terminus.