Human recombinant Galectin-13 protein, AF

Artikelnummer: BOB-PROTQ9UHV8-2-100UG
Artikelname: Human recombinant Galectin-13 protein, AF
Artikelnummer: BOB-PROTQ9UHV8-2-100UG
Hersteller Artikelnummer: PROTQ9UHV8-2-100ug
Alternativnummer: BOB-PROTQ9UHV8-2-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: LGALS13, GAL13, PLAC8, PP13
Galectin-13 (Gal-13) is a lectin family member and is one of the prototype galectins. It contains one carbohydrate recognition domain (CRD), responsible for beta-galactoside binding, and is biologically active as homodimers. Galectin-13 is expressed in the placenta, contributing to T cell apoptosis, immune regulation, and immune tolerance, which is indispensable for fetal development. For example, galectin-13 organizes crystal-like aggregates in the decidua, consequently attracting and killing maternal immune cells. Furthermore, galectin-13 is essential for driving neutrophil polarization in the placental-growth-permissive phenotype.
Molekulargewicht: The protein has a calculated MW of 16.9 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: Q9UHV8
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN with polyhistidine tag at the N-terminus.