RecombinantEGFR,His,Human

Artikelnummer: BWT-BK0195
Artikelname: RecombinantEGFR,His,Human
Artikelnummer: BWT-BK0195
Hersteller Artikelnummer: BK0195
Alternativnummer: BWT-BK0195-10UG,BWT-BK0195-1MG,BWT-BK0195-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
EGF Receptor,also known as ERBB, ERBB1 and HER1, is a type I transmembrane protein belonging to the tyrosine protein kinase family. It binds to a subset of EGF family ligands, including EGF, TGF-alpha, amphiregulin, EPGN, BTC, EREG and HBEGF. Ligand binding triggers receptor homo- or hetero-dimerization, which induces downstream kinase activation, tyrosine phosphorylation and cell signaling. EGF receptor signaling has been shown to regulate cell proliferation, differentiation, motility and apoptosis.
Molekulargewicht: 95-115 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENL QIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHL GSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTC PPLMLYNPTTYQ
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.