RecombinantFGF-9,Mouse

Artikelnummer: BWT-BK0201
Artikelname: RecombinantFGF-9,Mouse
Artikelnummer: BWT-BK0201
Hersteller Artikelnummer: BK0201
Alternativnummer: BWT-BK0201-10UG,BWT-BK0201-1MG,BWT-BK0201-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Fibroblast Growth Factor-9 (FGF-9), also known as Glia-activating factor (GAF) and HBGF-9, belongs to the heparin-binding growth factors family. It is a secreted protein that exists as monomer or homodimer. It interacts with FGFR-1, FGFR-2, FGFR-3, and FGFR-4 and plays an important role in regulating cell proliferation, differentiation and migration. It is reported that FGF-9 may be involved in glial cell growth and differentiation during development, gliosis during brain tissue regeneration, and glial tumor growth stimulation. Other reports indicate that FGF-9 plays a role in male development.
Molekulargewicht: ~28 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQ GTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYY VALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.