RecombinantG-CSF,Human(CHO-expressed)

Artikelnummer: BWT-BK0206
Artikelname: RecombinantG-CSF,Human(CHO-expressed)
Artikelnummer: BWT-BK0206
Hersteller Artikelnummer: BK0206
Alternativnummer: BWT-BK0206-10UG,BWT-BK0206-1MG,BWT-BK0206-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Human Granulocyte Colony Stimulating Factor (G-CSF) contains internal disulfide bonds. Among the family of colony-stimulating factors, Granulocyte Colony Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of Granulocyte Colony Stimulating Factor (G-CSF) can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits the synthesis of Granulocyte Colony Stimulating Factor (G-CSF). In epithelial, endothelial, and fibroblastic cells, the secretion of Granulocyte Colony Stimulating Factor (G-CSF) is induced by Interleukin-17.
Molekulargewicht: 18.7kDa, observed by non-reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHS GLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSF LEVSYRVLRHLAQP
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.