RecombinantGDNF,Human

Artikelnummer: BWT-BK0208
Artikelname: RecombinantGDNF,Human
Artikelnummer: BWT-BK0208
Hersteller Artikelnummer: BK0208
Alternativnummer: BWT-BK0208-10UG,BWT-BK0208-1MG,BWT-BK0208-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Glial cell line-derived neurotrophic factor (G-DNF) is a neurotrophic factors belong to TGF-beta super family necessary for neuron survival and phenotypic maintenance in central and peripheral nervous systems [1]. G-DNF has the potent to support the differentiation and survival of many neuron subpopulations, prominent for dopaminergic neurons [2] and motor neurons [3], as well as Purkinje cells and sympathetic neurons. Sertoli cells, type 1 astrocytes, Schwann cells, neurons, pinealocytes and skeletal muscle cells are known to express GDNF in human [4]. GDNF has shown to interact with GFRA2 and GDNF family receptor alpha 1 [5,6]. Mutations in this gene may be associated with Hirschsprungs disease, Parkinsons disease and amyotrophic lateral sclerosis (ALS) [7].The recombinant human G-DNF expressed in CHO cells is disulfide-linked homo-dimer, with an apparent molecular weight of ~30.4 kDa.
Molekulargewicht: 30.4 kDa (homo-dimer), observed by non-reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDL SFLDDNLVYHILRKHSAKRCGCI
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.