RecombinantGH,Human(CHO-expressed)

Artikelnummer: BWT-BK0210
Artikelname: RecombinantGH,Human(CHO-expressed)
Artikelnummer: BWT-BK0210
Hersteller Artikelnummer: BK0210
Alternativnummer: BWT-BK0210-10UG,BWT-BK0210-1MG,BWT-BK0210-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Growth hormone (GH), also known as somatotropin, is a member of a family of growth factors that includes prolactin, placental lactogens, proliferins, and somatolactin. It is synthesized primarily by somatotropes in the anterior pituitary and is stored in secretary granules. The pulsatile release of GH into circulation is regulated by the concerted actions of the hypothalamic hormones-GH-releasing hormone (GHRH) and somatostatin (SST) - as well as by signals from the periphery - ghrelin and leptin. The human GH cDNA encodes a 217 amino acid (aa) residue precursor protein with a 26 aa putative signal peptide. By alternative splicing, at least four isoforms of GH have been identified.
Molekulargewicht: 20-24 kDa, observed by non-reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: FPTIPLSRLFDNASLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISL LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY GLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.