RecombinantGranzymeB,Mouse

Artikelnummer: BWT-BK0214
Artikelname: RecombinantGranzymeB,Mouse
Artikelnummer: BWT-BK0214
Hersteller Artikelnummer: BK0214
Alternativnummer: BWT-BK0214-10UG,BWT-BK0214-1MG,BWT-BK0214-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Granzyme B is a serine protease most commonly found in the granules of cytotoxic lymphocytes (CTLs), natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also recently been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has been shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodeling.Recombinant Mouse Granzyme B produced in CHO cells is a polypeptide chain containing 227 amino acids. A fully biologically active molecule, rmGranzyme B has a molecular mass of 32 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molekulargewicht: 32 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: IIGGHEVKPHSRPYMALLSIKDQQPEAICGGFLIREDFVLTAAHCEGSIINVTLGAHNIK EQEKTQQVIPMVKCIPHPDYNPKTFSNDIMLLKLKSKAKRTRAVRPLNLPRRNVNVKPGD VCYVAGWGRMAPMGKYSNTLQEVELTVQKDRECESYFKNRYNKTNQICAGDPKTKRASFR GDSGGPLVCKKVAAGIVSYGYKDGSPPRAFTKVSSFLSWIKKTMKSS
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.