RecombinantGRO-alpha/KC/CXCL1,Mouse(CHO-expressed)

Artikelnummer: BWT-BK0216
Artikelname: RecombinantGRO-alpha/KC/CXCL1,Mouse(CHO-expressed)
Artikelnummer: BWT-BK0216
Hersteller Artikelnummer: BK0216
Alternativnummer: BWT-BK0216-1MG,BWT-BK0216-25UG,BWT-BK0216-5UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemokine receptor CXCR1 and CXCR2, and functions to chemoattract and activate neutrophils and basophils. It is also a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. GRO has also been reported to play a role in spinal cord development, angiogenesis, wound healing and tumorigenesis.
Molekulargewicht: 5-7 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.