RecombinantIL-13,His,Mouse(CHO-expressed)

Artikelnummer: BWT-BK0231
Artikelname: RecombinantIL-13,His,Mouse(CHO-expressed)
Artikelnummer: BWT-BK0231
Hersteller Artikelnummer: BK0231
Alternativnummer: BWT-BK0231-10UG,BWT-BK0231-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Ralpha and IL13Ralpha1 (or IL13Ralpha2). IL-13 inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion.
Molekulargewicht: 14-30 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTV SSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.