RecombinantIL-4,His,Rat

Artikelnummer: BWT-BK0244
Artikelname: RecombinantIL-4,His,Rat
Artikelnummer: BWT-BK0244
Hersteller Artikelnummer: BK0244
Alternativnummer: BWT-BK0244-25UG,BWT-BK0244-5UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Ralpha/common gamma chain and the IL4Ralpha-IL-13 Ralpha1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.
Molekulargewicht: 18-22 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.