RecombinantIL-8/CXCL8(8-79aa),Human(CHO-expressed)

Artikelnummer: BWT-BK0258
Artikelname: RecombinantIL-8/CXCL8(8-79aa),Human(CHO-expressed)
Artikelnummer: BWT-BK0258
Hersteller Artikelnummer: BK0258
Alternativnummer: BWT-BK0258-10UG,BWT-BK0258-1MG,BWT-BK0258-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis. Other functions of this protein, such as involvement in bronchiolitis pathogenesis, have also been reported.
Molekulargewicht: ~9 kDa, observed by reducing SDS-PAGE
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.