RecombinantPDGF-DD,Human

Artikelnummer: BWT-BK0281
Artikelname: RecombinantPDGF-DD,Human
Artikelnummer: BWT-BK0281
Hersteller Artikelnummer: BK0281
Alternativnummer: BWT-BK0281-10UG,BWT-BK0281-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rbeta homodimers and PDGF Ralpha/beta heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing.
Molekulargewicht: 19-21 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHE VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.