RecombinantTPO,Mouse

Artikelnummer: BWT-BK0289
Artikelname: RecombinantTPO,Mouse
Artikelnummer: BWT-BK0289
Hersteller Artikelnummer: BK0289
Alternativnummer: BWT-BK0289-10UG,BWT-BK0289-1MG,BWT-BK0289-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Thrombopoietin (TPO), also known as C-mpl ligand, MGDF and Thpo, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through MLP/C_MPL receptor. It stimulates the proliferation and maturation of megakaryocytes from their committed progenitor cells, and it regulates the production and circulation of platelets. TPO has also been reported to promote the apoptosis of hypoxia-sensitized neurons and to inhibit neuronal differentiation.
Molekulargewicht: 30-80 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQ LEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTA VPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGL FAGTSLQTLEAS
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml..