RecombinantAmphiregulin,Human

Artikelnummer: BWT-BK0297
Artikelname: RecombinantAmphiregulin,Human
Artikelnummer: BWT-BK0297
Hersteller Artikelnummer: BK0297
Alternativnummer: BWT-BK0297-10UG,BWT-BK0297-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-alpha, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-alpha receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulins extracellular domain is proteolytically processed to release the mature protein.
Molekulargewicht: 15~20 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.