RecombinantBetacellulin,Mouse(HEK293-expressed)

Artikelnummer: BWT-BK0299
Artikelname: RecombinantBetacellulin,Mouse(HEK293-expressed)
Artikelnummer: BWT-BK0299
Hersteller Artikelnummer: BK0299
Alternativnummer: BWT-BK0299-10UG,BWT-BK0299-1MG,BWT-BK0299-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes.
Molekulargewicht: 19-24 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.