RecombinantGRO-alpha/KC/CINC-1/CXCL1,Rat

Artikelnummer: BWT-BK0306
Artikelname: RecombinantGRO-alpha/KC/CINC-1/CXCL1,Rat
Artikelnummer: BWT-BK0306
Hersteller Artikelnummer: BK0306
Alternativnummer: BWT-BK0306-1MG,BWT-BK0306-25UG,BWT-BK0306-5UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.
Molekulargewicht: ~7.8 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.