RecombinantIFN-beta,Human

Artikelnummer: BWT-BK0307
Artikelname: RecombinantIFN-beta,Human
Artikelnummer: BWT-BK0307
Hersteller Artikelnummer: BK0307
Alternativnummer: BWT-BK0307-25UG,BWT-BK0307-5UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Interferon-beta (IFN-beta), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-alpha, -beta, tau, and -omega. IFN-beta plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.
Molekulargewicht: ~23 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.