RecombinantMCP-1/CCL2,Mouse

Artikelnummer: BWT-BK0320
Artikelname: RecombinantMCP-1/CCL2,Mouse
Artikelnummer: BWT-BK0320
Hersteller Artikelnummer: BK0320
Alternativnummer: BWT-BK0320-1MG,BWT-BK0320-25UG,BWT-BK0320-5UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several types of disease characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant mouse MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmMCP-1/CCL2 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molekulargewicht: 8 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.